bio-blast-searches
$
npx mdskill add GPTomics/bioSkills/bio-blast-searchesRuns remote BLAST searches against NCBI databases to find sequence similarity
- Identifies unknown sequences by comparing them to NCBI's nr/nt databases
- Uses Biopython's Bio.Blast module and NCBIWWW for remote query execution
- Selects appropriate BLAST programs (blastn, blastp, etc.) based on input sequence type
- Returns parsed XML results with E-values, identity scores, and sequence matches
SKILL.md
.github/skills/bio-blast-searchesView on GitHub ↗
---
name: bio-blast-searches
description: Run remote BLAST searches against NCBI databases using Biopython Bio.Blast. Use when identifying unknown sequences, finding homologs, or searching for sequence similarity against NCBI's nr/nt databases.
tool_type: python
primary_tool: Bio.Blast.NCBIWWW
---
## Version Compatibility
Reference examples tested with: BioPython 1.83+, NCBI BLAST+ 2.15+
Before using code patterns, verify installed versions match. If versions differ:
- Python: `pip show <package>` then `help(module.function)` to check signatures
If code throws ImportError, AttributeError, or TypeError, introspect the installed
package and adapt the example to match the actual API rather than retrying.
# BLAST Searches
**"BLAST this sequence against NCBI"** → Submit a query sequence to NCBI BLAST servers, retrieve XML results, and parse hits with E-values and identity scores.
- Python: `NCBIWWW.qblast()` + `NCBIXML.read()` (BioPython)
- CLI: `blastn -remote -db nt -query seq.fa` (BLAST+)
- R: `blast()` (rBLAST, local only)
Run BLAST searches against NCBI databases using Biopython's Bio.Blast module.
## Required Import
```python
from Bio.Blast import NCBIWWW, NCBIXML
from Bio import SeqIO
```
## BLAST Programs
| Program | Query | Database | Use Case |
|---------|-------|----------|----------|
| `blastn` | Nucleotide | Nucleotide | DNA/RNA sequence similarity |
| `blastp` | Protein | Protein | Protein sequence similarity |
| `blastx` | Nucleotide | Protein | Find protein hits for DNA query |
| `tblastn` | Protein | Nucleotide | Find DNA encoding protein-like |
| `tblastx` | Nucleotide | Nucleotide | Translated vs translated |
## Core Function
### NCBIWWW.qblast()
Submit a BLAST query to NCBI servers.
```python
from Bio.Blast import NCBIWWW
# Simple BLASTN search
result_handle = NCBIWWW.qblast('blastn', 'nt', sequence)
```
**Key Parameters:**
| Parameter | Description | Example |
|-----------|-------------|---------|
| `program` | BLAST program | `'blastn'`, `'blastp'` |
| `database` | Target database | `'nr'`, `'nt'`, `'refseq_rna'` |
| `sequence` | Query sequence | String or SeqRecord |
| `entrez_query` | Limit by Entrez query | `'Homo sapiens[organism]'` |
| `hitlist_size` | Max hits to return | `50` |
| `expect` | E-value threshold | `0.001` |
| `word_size` | Word size | `11` for blastn |
| `gapcosts` | Gap penalties | `'5 2'` (open, extend) |
| `format_type` | Output format | `'XML'` (default), `'Text'` |
## Common Databases
**Nucleotide:**
| Database | Description |
|----------|-------------|
| `nt` | All GenBank + EMBL + DDBJ |
| `refseq_rna` | RefSeq RNA sequences |
| `refseq_genomic` | RefSeq genomic sequences |
**Protein:**
| Database | Description |
|----------|-------------|
| `nr` | Non-redundant protein |
| `refseq_protein` | RefSeq proteins |
| `swissprot` | SwissProt (curated) |
| `pdb` | Protein structures |
## Parsing Results
### NCBIXML Parser
```python
from Bio.Blast import NCBIWWW, NCBIXML
# Run BLAST
result_handle = NCBIWWW.qblast('blastn', 'nt', sequence)
# Parse XML results
blast_record = NCBIXML.read(result_handle)
result_handle.close()
# Iterate hits
for alignment in blast_record.alignments:
print(f"Hit: {alignment.title}")
for hsp in alignment.hsps:
print(f" E-value: {hsp.expect}")
print(f" Score: {hsp.score}")
print(f" Identity: {hsp.identities}/{hsp.align_length}")
```
### Alignment/HSP Attributes
```python
# Alignment (hit) attributes
alignment.title # Hit description
alignment.accession # Accession number
alignment.length # Subject sequence length
alignment.hsps # List of HSPs
# HSP (High-scoring Segment Pair) attributes
hsp.score # Raw score
hsp.bits # Bit score
hsp.expect # E-value
hsp.identities # Number of identical positions
hsp.positives # Number of positive-scoring positions
hsp.gaps # Number of gaps
hsp.align_length # Alignment length
hsp.query # Aligned query sequence
hsp.match # Match line (| for identity)
hsp.sbjct # Aligned subject sequence
hsp.query_start # Query start position
hsp.query_end # Query end position
hsp.sbjct_start # Subject start position
hsp.sbjct_end # Subject end position
hsp.strand # Strand (blastn)
hsp.frame # Reading frame (blastx/tblastn)
```
## Code Patterns
### Basic BLASTN
```python
from Bio.Blast import NCBIWWW, NCBIXML
sequence = '''ATGAAAGCAATTTTCGTACTGAAAGGTTGGTGGCGCACTTCCTGA'''
print("Running BLASTN (this may take a minute)...")
result_handle = NCBIWWW.qblast('blastn', 'nt', sequence)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
print(f"\nFound {len(blast_record.alignments)} hits")
for alignment in blast_record.alignments[:5]:
hsp = alignment.hsps[0]
print(f"\n{alignment.title[:70]}...")
print(f" E-value: {hsp.expect:.2e}")
print(f" Identity: {hsp.identities}/{hsp.align_length} ({100*hsp.identities/hsp.align_length:.1f}%)")
```
### BLASTP with Organism Filter
```python
from Bio.Blast import NCBIWWW, NCBIXML
protein_seq = '''MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH'''
result_handle = NCBIWWW.qblast(
'blastp',
'nr',
protein_seq,
entrez_query='Mammalia[organism]',
hitlist_size=20,
expect=0.001
)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
for alignment in blast_record.alignments[:10]:
hsp = alignment.hsps[0]
print(f"{alignment.accession}: E={hsp.expect:.2e} - {alignment.title[:50]}...")
```
### BLAST from FASTA File
```python
from Bio import SeqIO
from Bio.Blast import NCBIWWW, NCBIXML
record = SeqIO.read('query.fasta', 'fasta')
result_handle = NCBIWWW.qblast('blastn', 'nt', record.seq)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
for alignment in blast_record.alignments[:5]:
print(f"{alignment.accession}: {alignment.title[:60]}...")
```
### Save Results to File
```python
from Bio.Blast import NCBIWWW
result_handle = NCBIWWW.qblast('blastn', 'nt', sequence)
# Save XML for later parsing
with open('blast_results.xml', 'w') as out:
out.write(result_handle.read())
result_handle.close()
# Parse saved file
from Bio.Blast import NCBIXML
with open('blast_results.xml') as f:
blast_record = NCBIXML.read(f)
```
### Extract Top Hits
**Goal:** Run a BLAST search and return a structured list of top hits with identity, coverage, and E-values.
**Approach:** Submit query with `qblast`, parse the XML result, and extract key metrics from each alignment's best HSP.
**Reference (BioPython 1.83+):**
```python
def get_top_hits(sequence, program='blastn', database='nt', num_hits=10, evalue=0.01):
result_handle = NCBIWWW.qblast(
program, database, sequence,
hitlist_size=num_hits,
expect=evalue
)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
hits = []
for alignment in blast_record.alignments:
hsp = alignment.hsps[0]
hits.append({
'accession': alignment.accession,
'title': alignment.title,
'evalue': hsp.expect,
'identity': hsp.identities / hsp.align_length,
'coverage': hsp.align_length / blast_record.query_length
})
return hits
hits = get_top_hits(my_sequence, num_hits=5)
for hit in hits:
print(f"{hit['accession']}: {hit['identity']:.1%} identity, E={hit['evalue']:.2e}")
```
### BLASTX (DNA to Protein)
```python
from Bio.Blast import NCBIWWW, NCBIXML
dna_sequence = '''ATGAAAGCAATTTTCGTACTGAAAGGTTGGTGGCGCACTTCCTGA'''
result_handle = NCBIWWW.qblast('blastx', 'nr', dna_sequence)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
for alignment in blast_record.alignments[:5]:
hsp = alignment.hsps[0]
print(f"{alignment.accession}: frame {hsp.frame}, E={hsp.expect:.2e}")
print(f" {alignment.title[:60]}...")
```
### Multiple Sequences
```python
from Bio import SeqIO
from Bio.Blast import NCBIWWW, NCBIXML
import time
def blast_multiple(fasta_file, program='blastn', database='nt'):
results = {}
for record in SeqIO.parse(fasta_file, 'fasta'):
print(f"BLASTing {record.id}...")
result_handle = NCBIWWW.qblast(program, database, str(record.seq), hitlist_size=5)
blast_record = NCBIXML.read(result_handle)
result_handle.close()
results[record.id] = blast_record
time.sleep(5) # Be nice to NCBI servers
return results
```
### Filter by Identity/Coverage
**Goal:** Retain only BLAST hits meeting minimum identity and query coverage thresholds.
**Approach:** Iterate all alignments and HSPs, compute identity and coverage fractions, and collect those passing both cutoffs.
**Reference (BioPython 1.83+):**
```python
def filter_blast_hits(blast_record, min_identity=0.9, min_coverage=0.8):
query_length = blast_record.query_length
filtered = []
for alignment in blast_record.alignments:
for hsp in alignment.hsps:
identity = hsp.identities / hsp.align_length
coverage = hsp.align_length / query_length
if identity >= min_identity and coverage >= min_coverage:
filtered.append({
'accession': alignment.accession,
'title': alignment.title,
'identity': identity,
'coverage': coverage,
'evalue': hsp.expect
})
return filtered
```
## Common Errors
| Error | Cause | Solution |
|-------|-------|----------|
| Timeout | NCBI servers busy | Retry later, use smaller query |
| No hits | Wrong database or program | Check program/database match |
| Empty results | E-value too stringent | Increase expect parameter |
| URLError | Network issue | Check connection, retry |
## Timing Notes
- Remote BLAST can take 30 seconds to several minutes
- Longer queries take longer
- Peak times (US business hours) may be slower
- For many queries, consider local BLAST
## Decision Tree
```
Need to BLAST a sequence?
├── DNA query?
│ ├── Against DNA database? → blastn
│ └── Against protein database? → blastx
├── Protein query?
│ ├── Against protein database? → blastp
│ └── Against DNA database? → tblastn
├── Want to limit organisms?
│ └── Use entrez_query parameter
├── Need many searches?
│ └── Consider local-blast skill
└── Need results fast?
└── Use local-blast skill
```
## Related Skills
- local-blast - Run BLAST locally for faster, unlimited searches
- entrez-fetch - Fetch full records for BLAST hits
- sequence-io - Read query sequences from files