bio-structural-biology-modern-structure-prediction
$
npx mdskill add GPTomics/bioSkills/bio-structural-biology-modern-structure-predictionPredict protein structures using modern ML models like AlphaFold3 and ESMFold
- Solves the task of predicting novel protein or complex structures
- Uses tools including AlphaFold3, ESMFold, Chai-1, and Boltz-1
- Chooses models based on speed, accuracy, and input requirements
- Returns predicted structures in standard formats for downstream analysis
SKILL.md
.github/skills/bio-structural-biology-modern-structure-predictionView on GitHub ↗
---
name: bio-structural-biology-modern-structure-prediction
description: Predict protein structures using modern ML models including AlphaFold3, ESMFold, Chai-1, and Boltz-1. Use when predicting structures for novel proteins, protein complexes, or when comparing predictions across multiple methods.
tool_type: python
primary_tool: ESMFold
---
## Version Compatibility
Reference examples tested with: BioPython 1.83+, numpy 1.26+
Before using code patterns, verify installed versions match. If versions differ:
- Python: `pip show <package>` then `help(module.function)` to check signatures
- CLI: `<tool> --version` then `<tool> --help` to confirm flags
If code throws ImportError, AttributeError, or TypeError, introspect the installed
package and adapt the example to match the actual API rather than retrying.
# Modern Structure Prediction
**"Predict the structure of my protein"** → Run ML-based structure prediction using ESMFold (single-sequence, fast), AlphaFold3 (MSA-based, highest accuracy), Chai-1, or Boltz-1 and compare predictions across methods.
- Python: ESMFold API via `requests`, local ESMFold with `esm.pretrained`
Predict protein structures using state-of-the-art machine learning models. This covers cloud APIs, local installations, and interpretation of results.
## Model Comparison
| Model | Complexes | Ligands | Speed | Access |
|-------|-----------|---------|-------|--------|
| AlphaFold3 | Yes | Yes | Slow | Server only (2025) |
| ESMFold | No | No | Fast | API or local |
| Chai-1 | Yes | Yes | Moderate | Local or API |
| Boltz-1 | Yes | Yes | Moderate | Local |
| ColabFold | No* | No | Moderate | Colab/local |
*ColabFold can predict complexes with AlphaFold-Multimer.
## ESMFold (Fastest Single-Chain)
**Goal:** Predict a protein's 3D structure from its amino acid sequence using the ESMFold language model, which requires no MSA and runs in seconds.
**Approach:** Submit the sequence to the ESMFold API (or run locally with the esm library), retrieve the predicted PDB coordinates, and assess per-residue confidence via pLDDT scores in the B-factor column.
### Via ESM Atlas API
```python
import requests
def predict_esmfold(sequence):
'''Predict structure using ESMFold API'''
url = 'https://api.esmatlas.com/foldSequence/v1/pdb/'
response = requests.post(url, data=sequence, timeout=300)
if response.status_code == 200:
return response.text
raise Exception(f'ESMFold failed: {response.status_code}')
sequence = 'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH'
pdb_text = predict_esmfold(sequence)
with open('predicted.pdb', 'w') as f:
f.write(pdb_text)
```
### Local ESMFold
```python
import torch
import esm
def predict_esmfold_local(sequence, device='cuda'):
'''Run ESMFold locally (requires ~16GB GPU memory)'''
model = esm.pretrained.esmfold_v1()
model = model.eval().to(device)
with torch.no_grad():
output = model.infer_pdb(sequence)
return output
# Extract pLDDT from ESMFold output
def extract_esmfold_plddt(pdb_text):
plddt = {}
for line in pdb_text.split('\n'):
if line.startswith('ATOM') and line[12:16].strip() == 'CA':
resnum = int(line[22:26])
bfactor = float(line[60:66])
plddt[resnum] = bfactor
return plddt
```
## AlphaFold3 (Server)
AlphaFold3 predictions via the server at alphafoldserver.com.
### Prepare Input JSON
```python
import json
def create_af3_input(sequences, job_name='prediction'):
'''Create AlphaFold3 server input JSON'''
entities = []
for i, seq in enumerate(sequences):
entities.append({
'type': 'protein',
'sequence': seq,
'count': 1
})
job = {
'name': job_name,
'modelSeeds': [1],
'sequences': entities
}
return json.dumps(job, indent=2)
# Single protein
input_json = create_af3_input(['MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH'])
# Protein complex
input_json = create_af3_input([
'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH',
'MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSS'
])
```
### Process AF3 Results
```python
import json
from Bio.PDB import PDBParser
import numpy as np
def analyze_af3_result(result_dir):
'''Analyze AlphaFold3 prediction results'''
# Load summary
with open(f'{result_dir}/summary_confidences.json') as f:
summary = json.load(f)
# Extract confidence metrics
iptm = summary.get('iptm', None) # Interface pTM (complexes)
ptm = summary.get('ptm', None) # Predicted TM-score
ranking = summary.get('ranking_score', None)
print(f'pTM: {ptm:.3f}' if ptm else 'pTM: N/A')
print(f'ipTM: {iptm:.3f}' if iptm else 'ipTM: N/A')
return summary
```
### AF3 Confidence Interpretation
| Metric | Range | Interpretation |
|--------|-------|----------------|
| pTM | 0-1 | Overall structure confidence |
| ipTM | 0-1 | Interface prediction quality |
| pLDDT | 0-100 | Per-residue confidence |
| PAE | 0-30A | Position error between residue pairs |
## Chai-1 (Local Open-Source)
### Installation
```bash
pip install chai-lab
```
### Basic Prediction
```python
from chai_lab.chai1 import run_inference
import numpy as np
from pathlib import Path
def predict_chai1(fasta_path, output_dir='chai_output'):
'''Run Chai-1 structure prediction'''
Path(output_dir).mkdir(exist_ok=True)
candidates = run_inference(
fasta_file=Path(fasta_path),
output_dir=Path(output_dir),
num_trunk_recycles=3, # 3: Standard. Use 5+ for difficult targets.
num_diffn_timesteps=200, # 200: Standard. 500 for higher quality.
seed=42,
device='cuda:0'
)
return candidates
# Candidates are sorted by confidence
# candidates.cif files contain predicted structures
```
### Chai-1 with Ligands
```python
# Chai-1 supports protein-ligand complexes
# Include ligand SMILES in input FASTA with special format
def create_chai_fasta_with_ligand(protein_seq, ligand_smiles, output_file):
'''Create Chai-1 input with protein and ligand'''
with open(output_file, 'w') as f:
f.write('>protein|chain_A\n')
f.write(f'{protein_seq}\n')
f.write('>ligand|chain_B\n')
f.write(f'{ligand_smiles}\n')
```
## Boltz-1 (Open-Source Complex Prediction)
### Installation
```bash
pip install boltz
```
### Basic Prediction
```python
from boltz import Boltz1
def predict_boltz1(sequences, output_dir='boltz_output'):
'''Run Boltz-1 structure prediction'''
model = Boltz1()
result = model.predict(
sequences=sequences,
output_dir=output_dir,
recycling_steps=3, # 3: Standard. Increase for difficult targets.
sampling_steps=200 # 200: Standard. 500 for publication quality.
)
return result
```
### Boltz-1 for Complexes
```python
# Boltz-1 handles heteromeric complexes
def predict_complex_boltz(chain_sequences):
'''Predict protein complex with Boltz-1'''
model = Boltz1()
result = model.predict(
sequences=chain_sequences, # List of sequences for each chain
output_dir='complex_output'
)
# Extract interface metrics
return result
```
## ColabFold (AlphaFold2 + MMseqs2)
### Command Line
```bash
# Install ColabFold
pip install colabfold
# Run prediction
colabfold_batch input.fasta output_dir/
# With custom templates
colabfold_batch input.fasta output_dir/ --templates
# For complexes (use : to separate chains)
# Create FASTA like: >complex\nSEQUENCE1:SEQUENCE2
```
### Python API
```python
from colabfold.batch import run_colabfold
def predict_colabfold(fasta_file, output_dir, use_templates=False):
'''Run ColabFold prediction'''
run_colabfold(
input_path=fasta_file,
result_dir=output_dir,
use_templates=use_templates,
num_models=5, # 5: Standard. Use 1 for quick predictions.
num_recycles=3, # 3: Standard. Increase for multimers.
model_order=[1,2,3,4,5]
)
```
## Comparing Predictions
```python
from Bio.PDB import PDBParser, Superimposer
import numpy as np
def compare_predictions(pdb_files, labels=None):
'''Compare multiple structure predictions'''
parser = PDBParser(QUIET=True)
structures = [parser.get_structure(f'model_{i}', f) for i, f in enumerate(pdb_files)]
# Extract CA atoms from first chain
def get_ca_atoms(struct):
return [r['CA'] for r in struct[0].get_residues() if 'CA' in r]
all_atoms = [get_ca_atoms(s) for s in structures]
# Pairwise RMSD
n = len(structures)
rmsd_matrix = np.zeros((n, n))
for i in range(n):
for j in range(i+1, n):
min_len = min(len(all_atoms[i]), len(all_atoms[j]))
super_imposer = Superimposer()
super_imposer.set_atoms(all_atoms[i][:min_len], all_atoms[j][:min_len])
rmsd_matrix[i,j] = rmsd_matrix[j,i] = super_imposer.rms
return rmsd_matrix
# Compare ESMFold vs AlphaFold3 vs Chai-1
rmsd = compare_predictions(['esmfold.pdb', 'af3.pdb', 'chai1.pdb'])
print('RMSD matrix:')
print(rmsd)
```
## When to Use Each Model
| Scenario | Recommended Model |
|----------|-------------------|
| Quick single-chain prediction | ESMFold (API) |
| Highest accuracy single chain | AlphaFold3 or ColabFold |
| Protein-protein complex | AlphaFold3, Chai-1, or Boltz-1 |
| Protein-ligand complex | AlphaFold3 or Chai-1 |
| No GPU available | ESMFold API or AlphaFold3 server |
| Large-scale screening | ESMFold (local) |
| Open-source requirement | Chai-1 or Boltz-1 |
## Memory Requirements
| Model | GPU Memory | Notes |
|-------|------------|-------|
| ESMFold | ~16 GB | Sequence length dependent |
| ColabFold | ~8-16 GB | Model size dependent |
| Chai-1 | ~24 GB | Complex size dependent |
| Boltz-1 | ~24 GB | Complex size dependent |
## Related Skills
- alphafold-predictions - Download pre-computed AlphaFold structures
- structure-io - Parse and write structure files
- geometric-analysis - RMSD, superimposition, distance calculations
- structure-navigation - Navigate predicted structure hierarchy